PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G408500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 177aa    MW: 19740.2 Da    PI: 6.2908
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G408500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.91.9e-39111101100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+l+rkC+++C++apyfp e+ ++fa +hk+FGasn +k+l+++p+++r +a++slv+eAear++dPv+G++g ++ lq ++ ql++
  Aqcoe1G408500.1.p  11 SCAACKLLKRKCTPNCIFAPYFPPERLQSFAKIHKVFGASNASKILSEVPQDQRAEAVNSLVFEAEARVNDPVHGCIGAMNLLQTKMVQLQH 102
                        6******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la ++++
  Aqcoe1G408500.1.p 103 DLAITRAH 110
                        ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.08610111IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-3711108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MKRCDSRSAS SCAACKLLKR KCTPNCIFAP YFPPERLQSF AKIHKVFGAS NASKILSEVP  60
QDQRAEAVNS LVFEAEARVN DPVHGCIGAM NLLQTKMVQL QHDLAITRAH LACYTNDNFQ  120
DLHHCHDPVE NYVGAIPLDG YDDIGRESNS DVPKSLELQQ HDDERLDYPY GSFCQQ*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138415.17e-55PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL86e-51LBD21_ARATH; LOB domain-containing protein 21
TrEMBLD7T4L72e-52D7T4L7_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g01450.t017e-52(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.11e-42LOB domain-containing protein 21